PTM Viewer PTM Viewer

AT3G22620.1

Arabidopsis thaliana [ath]

Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

No PTMs currently found

PLAZA: AT3G22620
Gene Family: HOM05D002080
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 203

MSKIISLVVAMIAVLALPIRGQQQPLSQCTPSMMTTVSPCMGFITNSSSNGTSPSSDCCNSLRSLTTGGMGCLCLIVTGTVPFNIPINRTTAVSLPRACNMPRVPLQCQANIAPAAAPGPAATFGPSMSPGPETDPIVPEPTPAAQTPQSDTTRPFTPSVDGGAPTSDDGGSTSRPSETPSSAYALSPSLLFFSIALVALKFY

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR016140 10 108
Molecule Processing
Show Type From To
Propeptide 173 203
Signal Peptide 1 21

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here